Page - 29 - in Cancer Nanotheranostics - What Have We Learnd So Far?

Condeetal. Biofunctionalizationandsurfacechemistryof inorganicnanoparticles Frigell, J., García, I., Gómez-Vallejo, V., Llop, J., and Penadés, S. (2014). 68Ga- labeledgoldglyconanoparticles forexploringblood-brainbarrierpermeability: preparation,biodistributionstudies, and improvedbrainuptakevianeuropep- tideconjugation. J.Am.Chem.Soc.136,449–457.doi:10.1021/ja411096m Fuentes, M., Mateo, C., Guisán, J. M., and Fernández-Lafuente, R. (2005). Preparationof inertmagneticnano-particles for thedirectedimmobilizationof antibodies.Biosens.Bioelectron.20,1380–1387.doi:10.1016/j.bios.2004.06.004 Garcia, I., Marradi, M., and Penades, S. (2010). Glyconanoparticles: multi- functional nanomaterials for biomedical applications.Nanomedicine(Lond.)5, 777–792.doi:10.2217/nnm.10.48 Ghanem,M.A.,Bartlett,P.N.,deGroot,P., andZhukov,A. (2004).Adouble tem- platedelectrodepositionmethodforthefabricationofarraysofmetalnanodots. Electrochem.commun.6,447–453.doi:10.1016/j.elecom.2004.03.001 Ghosh, P. S., Kim, C. K., Han, G., Forbes, N. S., and Rotello, V. M. (2008). Efficient gene delivery vectors by tuning the surface charge density of amino acid-functionalized gold nanoparticles. ACS Nano 2, 2213–2218. doi: 10.1021/nn800507t Gil,P.R.,andParak,W.J. (2008).Compositenanoparticles takeaimatcancer.ACS Nano2,2200–2205.doi:10.1021/nn800716j Gilchrist, R. K., Medal, R., Shorey,W. D., Hanselman, R. C., Parrott, J. C., and Taylor,C.B.(1957).Selective inductiveheatingof lymphnodes.Ann.Surg.146, 596–606.doi:10.1097/00000658-195710000-00007 Gill, R., Zayats, M., and Willner, I. (2008). Semiconductor quantum dots for bioanalysis. Angew. Chem. Int. Ed. Engl. 47, 7602–7625. doi: 10.1002/anie.200800169 Giersig,M.,andMulvaney,P.(1993).Preparationoforderedcolloidmonolayersby electrophoreticdeposition.Langmuir9,3408–3413.doi:10.1021/la00036a014 Goldman, E. R., Anderson, G. P., Tran, P. T., Mattoussi, H., Charles, P. T., and Mauro,J.M.(2002).Conjugationof luminescentquantumdotswithantibodies using an engineered adaptor protein to provide new reagents for fluoroim- munoassays.Anal.Chem.74,841–847.doi:10.1021/ac010662m Goluch, E. D., Nam, J.M., Georganopoulou, D. G., Chiesl, T. N., Shaikh, K. A., Ryu,K. S., et al. (2006).Abio-barcode assay for on-chip attomolar-sensitivity proteindetection.LabChip6,1293–1299.doi:10.1039/b606294f Grabarek, Z., and Gergely, J. (1990). Zero-length crosslinking procedure with the use of active esters. Anal. Biochem. 185, 131–135. doi: 10.1016/0003- 2697(90)90267-D Grazú, V., Moros, M., and Sánchez-Espinel, C. (2012). “Chapter 14 - Nanocarriers as nanomedicines: design concepts and recent advances,” in Frontiers of NanoscienceNanobiotechnology InorganicNanoparticles vsOrganic Nanoparticles, eds J. M. de la Fuente and V. Grazu (Oxford, UK: Elsevier), 337–440.doi:10.1016/B978-0-12-415769-9.00014-5 Gump, J. M., and Dowdy, S. F. (2007). TAT transduction: the molecular mechanism and therapeutic prospects. Trends Mol. Med. 13, 443–448. doi: 10.1016/j.molmed.2007.08.002 Guo, S.,Huang,Y., Jiang,Q., Sun,Y.,Deng, L., Liang,Z., et al. (2010). Enhanced gene delivery and siRNA silencing by gold nanoparticles coated with charge- reversalpolyelectrolyte.ACSNano4,5505–5511.doi:10.1021/nn101638u Guo,Y.M.,Wang,Z.,Qu,W.S.,Shao,H.W.,andJiang,X.Y. (2011).Colorimetric detection of mercury, lead and copper ions simultaneously using protein- functionalized gold nanoparticles. Biosens. Bioelectron. 26, 4064–4069. doi: 10.1016/j.bios.2011.03.033 Han, A., Dufva, M., Belleville, E., and Christensen, C. B. (2003). Detection of analyte binding tomicroarrays using gold nanoparticle labels and a desktop scanner.LabChip3,329–332.doi:10.1039/b310814g Hanini, A., Schmitt, A., Kacem, K., Chau, F., Ammar, S., andGavard, J. (2011). Evaluationof ironoxidenanoparticle biocompatibility. Int. J.Nanomedicine6, 787–794.doi:10.2147/IJN.S17574 Hao, J.,Huang, L. L., Zhang, R.,Wang,H. Z., andXie,H. Y. (2012). Amild and reliablemethodtolabelenvelopedviruswithquantumdotsbycopper-freeclick chemistry.Anal.Chem.84,8364–8370.doi:10.1021/ac301918t Harris, T. J., vonMaltzahn,G., Lord,M. E., Park, J.H., Agrawal, A.,Min,D.H., et al. (2008). Protease-triggered unveiling of bioactive nanoparticles. Small 4, 1307–1312.doi:10.1002/smll.200701319 Haun, J.B.,Castro,C.M.,Wang,R.,Peterson,V.M.,Marinelli,B.S.,Lee,H., et al. (2011).Micro-NMRforrapidmolecularanalysisofhumantumorsamples.Sci. Transl.Med.3:71ra16.doi:10.1126/scitranslmed.3002048 Haun, J. B., Devaraj, N. K., Hilderbrand, S. A., Lee, H., and Weissleder, R. (2010). Bioorthogonal chemistry amplifies nanoparticle binding and enhances the sensitivity of cell detection. Nat. Biotechnol. 5, 660–665. doi: 10.1038/nnano.2010.148 He, X., Gao, J., Gambhir, S. S., and Cheng, Z. (2010). Near-infrared fluorescent nanoprobes for cancermolecular imaging: status and challenges.TrendsMol. Med.16,574–583.doi:10.1016/j.molmed.2010.08.006 Heath, J.R.,andDavis,M.E.(2008).Nanotechnologyandcancer.Annu.Rev.Med. 59,251–265.doi:10.1146/annurev.med.59.061506.185523 Hein,C.D., Liu,X.M., andWang,D. (2008).Click chemistry, apowerful tool for pharmaceutical sciences.Pharm.Res.25, 2216–2230.doi: 10.1007/s11095-008- 9616-1 Hein, J. E., and Fokin, V.V. (2010). Copper-catalyzed azide-alkyne cycloaddition (CuAAC) and beyond: new reactivity of copper(I) acetylides.Chem. Soc. Rev. 39,1302–1315.doi:10.1039/b904091a Hermanson, G. T. (2008). Bioconjugate Techniques, 2nd Edn. London, UK: AcademicPress;Elsevier. Himo, F., Lovell, T., Hilgraf, R., Rostovtsev, V. V., Noodleman, L., Sharpless, K. B., et al. (2005). Copper(I)-catalyzed synthesis of azoles. DFT study predicts unprecedented reactivity and intermediates. J. Am. Chem. Soc. 127, 210–216. doi:10.1021/ja0471525 Hodenius, M., Hieronymus, T., Zenke, M., Becker, C., Elling, L., Bornemann, J., et al. (2012). Magnetically triggered clustering of biotinylated iron oxide nanoparticles in the presence of streptavidinylated enzymes.Nanotechnology 23:355707.doi:10.1088/0957-4484/23/35/355707 Hong, R.,Han,G., Fernandez, J.M., Kim, B. J., Forbes,N. S., andRotello, V.M. (2006). Glutathione-mediated delivery and release usingmonolayer protected nanoparticlecarriers. J.Am.Chem.Soc.128,1078–1079.doi:10.1021/ja056726i Hong,V., Presolski, S. I.,Ma,C., andFinn,M.G. (2009).Analysis andoptimiza- tionofcopper-catalyzedazide-alkynecycloaddition forbioconjugation.Angew. Chem. Int.EdEngl.48,9879–9883.doi:10.1002/anie.200905087 Hu, R., Yong, K. T., Roy, I., Ding, H., Law, W. C., Cai, H., et al. (2010). Functionalizednear-infraredquantumdots for invivo tumorvasculature imag- ing.Nanotechnology21:145105.doi:10.1088/0957-4484/21/14/145105 Hua, X. F., Liu, T. C., Cao, Y. C., Liu, B.,Wang,H.Q.,Wang, J.H. et al. (2006). Characterization of the coupling of quantumdots and immunoglobulin anti- bodies.Anal.Bioanal.Chem.386,1665–1671.doi:10.1007/s00216-006-0807-5 Huang,X., Jain,P.K.,El-Sayed, I.H., andEl-Sayed,M.A. (2007).Goldnanoparti- cles: interestingopticalproperties andrecentapplications incancerdiagnostics andtherapy.Nanomedicine(Lond.)2,681–693.doi:10.2217/17435889.2.5.681 Hurst, S. J., Lytton-Jean, A. K. R., andMirkin, C. A. (2006). Maximizing DNA loadingona rangeof goldnanoparticle sizes.Anal.Chem.78, 8313–8318. doi: 10.1021/ac0613582 Huschka, R., Barhoumi, A., Liu, Q., Roth, J. A., Ji, L., and Halas, N. J. (2012).Gene silencingbygoldnanoshell-mediateddeliveryand laser-triggered release of antisense oligonucleotide and siRNA.ACSNano 6, 7681–7691. doi: 10.1021/nn301135w Hwu, J. R., Lin, Y. S., Josephrajan, T., Hsu,M.H., Cheng, F. Y., Yeh, C. S., et al. (2009).TargetedPaclitaxelbyconjugationto ironoxideandgoldnanoparticles. J.Am.Chem.Soc.131,66–68.doi:10.1021/ja804947u Jain,P.K.,Lee,K.S.,El-Sayed,I.H.,andEl-Sayed,M.A.(2006).Calculatedabsorp- tion and scattering properties of gold nanoparticles of different size, shape, and composition: applications inbiological imaging andbiomedicine. J. Phys. Chem.B110,7238–7248.doi:10.1021/jp057170o Janczewski, D., Tomczak, N., Han,M. Y., and Vancso, G. J. (2011). Synthesis of functionalizedamphiphilicpolymers for coatingquantumdots.Nat.Protoc.6, 1546–1553.doi:10.1038/nprot.2011.381 Jang, L. S., and Keng, H. K. (2008). Modified fabrication process of protein chips using a short-chain self-assembledmonolayer.Biomed.Microdevices. 10, 203–211.doi:10.1007/s10544-007-9126-7 Johannsen,M.,Gneveckow,U., Eckelt, L., Feussner,A.,Waldofner,N., Scholz, R., etal. (2005).Clinicalhyperthermiaofprostatecancerusingmagneticnanopar- ticles: presentation of a new interstitial technique. Int. J. Hyperthermia 21, 637–647.doi:10.1080/02656730500158360 Johannsen,M., Thiesen, B.,Wust, P., and Jordan, A. (2010).Magnetic nanopar- ticle hyperthermia for prostate cancer. Int. J. Hyperthermia 26, 790–795. doi: 10.3109/02656731003745740 Jordan,A., Scholz,R.,Maier-Hauff,K., Johannsen,M.,Wust,P.,Nadobny, J., et al. (2001).Presentationofanewmagneticfieldtherapysystemforthetreatmentof humansolid tumorswithmagneticfluidhyperthermia. J.Magn.Magn.Mater. 225,118–126.doi:10.1016/S0304-8853(00)01239-7 Frontiers inChemistry | ChemicalEngineering July2014 |Volume2 |Article48 | 29